PDB entry 1r2z

View 1r2z on RCSB PDB site
Description: MutM (Fpg) bound to 5,6-dihydrouracil (DHU) containing DNA
Deposited on 2003-09-30, released 2003-10-14
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-06, with a file datestamp of 2004-01-06.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.208
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2zA (A:)
    mpqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgk
    flkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvy
    akeeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdes
    lfragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhly
    vygrqgnpckrcgtpiektvvagrgthycprcqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2zA (A:)
    pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
    lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
    keeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdesl
    fragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhlyv
    ygrqgnpckrcgtpiektvvagrgthycprcqr