PDB entry 1r2y

View 1r2y on RCSB PDB site
Description: MutM (Fpg) bound to 8-oxoguanine (oxoG) containing DNA
Class: hydrolase/DNA
Keywords: DNA repair, DNA glycosylase
Deposited on 2003-09-30, released 2003-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 2004-01-06, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MutM
    Species: Bacillus stearothermophilus
    Gene: mutM
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1r2ya1, d1r2ya2, d1r2ya3
  • Chain 'B':
    Compound: 5'-d(*ap*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*ap*cp*gp*c)-3'
  • Chain 'C':
    Compound: 5'-d(*tp*gp*cp*gp*tp*cp*cp*ap*(8og)p*gp*tp*cp*tp*ap*cp*c)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2yA (A:)
    mpqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgk
    flkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvy
    akeeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdes
    lfragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhly
    vygrqgnpckrcgtpiektvvagrgthycprcqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2yA (A:)
    pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
    lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
    keeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdesl
    fragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhlyv
    ygrqgnpckrcgtpiektvvagrgthycprcqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.