PDB entry 1r2x

View 1r2x on RCSB PDB site
Description: Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of EF-Tu ternary complex (GDP.Kirromycin) bound 70S ribosome
Class: RNA binding protein/RNA
Keywords: rna, ribosomal protein, RNA BINDING PROTEIN-RNA COMPLEX
Deposited on 2003-09-30, released 2003-11-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: EM
Resolution: 9 Å
R-factor: N/A
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L11
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29395
      • insertion (71)
    Domains in SCOPe 2.04: d1r2xa_
  • Chain 'C':
    Compound: 58nts of 23S rRNA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2xA (A:)
    akkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvy
    edksftfiikteppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnans
    leaamkiiegtaksmgievvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2xA (A:)
    iklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksftf
    iikteppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievv
    

  • Chain 'C':
    No sequence available.