PDB entry 1r2w

View 1r2w on RCSB PDB site
Description: Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of the 70S ribosome
Deposited on 2003-09-30, released 2003-11-04
The last revision prior to the SCOP 1.71 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: EM
Resolution: 9 Å
R-factor: N/A
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1r2wa_
  • Chain 'C':
    Domains in SCOP 1.71: d1r2wc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2wA (A:)
    akkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvy
    edksftfiikteppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnans
    leaamkiiegtaksmgievvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2wA (A:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiikteppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamk
    iiegtaksmgievv
    

  • Chain 'C':
    No sequence available.