PDB entry 1r2u

View 1r2u on RCSB PDB site
Description: NMR structure of the N domain of trout cardiac troponin C at 30 C
Class: metal binding protein
Keywords: EF-hand, METAL BINDING PROTEIN
Deposited on 2003-09-29, released 2004-06-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1r2ua_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r2uA (A:)
    mndiykaaveqltdeqknefkaafdifiqdaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds