PDB entry 1r2u

View 1r2u on RCSB PDB site
Description: NMR structure of the N domain of trout cardiac troponin C at 30 C
Class: metal binding protein
Keywords: EF-hand
Deposited on 2003-09-29, released 2004-06-08
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-08, with a file datestamp of 2007-06-04.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: troponin c
  Species: Oncorhynchus mykiss
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7ZZB9 (0-88)
  Domains in SCOP 1.73: d1r2ua_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1r2uA (A:)
  mndiykaaveqltdeqknefkaafdifiqdaedgcistkelgkvmrmlgqnptpeelqem
  idevdedgsgtvdfdeflvmmvrcmkdds