PDB entry 1r2u

View 1r2u on RCSB PDB site
Description: nmr structure of the n domain of trout cardiac troponin c at 30 c
Deposited on 2003-09-29, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1r2ua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1r2uA (A:)
  mndiykaaveqltdeqknefkaafdifiqdaedgcistkelgkvmrmlgqnptpeelqem
  idevdedgsgtvdfdeflvmmvrcmkdds