PDB entry 1r2s

View 1r2s on RCSB PDB site
Description:
Deposited on 2003-09-29, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.174
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1r2sa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1r2sb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1r2sc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1r2sd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2sA (A:)
    apsrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalseg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2sA (A:)
    psrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkiav
    aaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalsegl
    gviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefv
    diinakq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r2sB (B:)
    apsrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalseg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2sB (B:)
    srkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkiava
    aqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalseglg
    viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq
    evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
    iinakq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r2sC (C:)
    apsrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalseg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2sC (C:)
    psrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkiav
    aaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalsegl
    gviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefv
    diinakq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r2sD (D:)
    apsrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalseg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2sD (D:)
    psrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkiav
    aaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalsegl
    gviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefv
    diinakq