PDB entry 1r2r

View 1r2r on RCSB PDB site
Description: crystal structure of rabbit muscle triosephosphate isomerase
Class: isomerase
Keywords: TIM; Closed loop conformation in the ligand-free state; Conformational heterogeneity; Tim-barrel, ISOMERASE
Deposited on 2003-09-29, released 2003-12-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.161
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r2ra_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r2rb_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r2rc_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r2rd_
  • Heterogens: DMS, MG, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2rA (A:)
    apsrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalseg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2rA (A:)
    srkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkiava
    aqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalseglg
    viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq
    evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
    iinakq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r2rB (B:)
    apsrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalseg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2rB (B:)
    psrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkiav
    aaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalsegl
    gviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefv
    diinakq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r2rC (C:)
    apsrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalseg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2rC (C:)
    psrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkiav
    aaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalsegl
    gviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefv
    diinakq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r2rD (D:)
    apsrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalseg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2rD (D:)
    psrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkiav
    aaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalsegl
    gviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefv
    diinakq