PDB entry 1r2n

View 1r2n on RCSB PDB site
Description: NMR structure of the all-trans retinal in dark-adapted Bacteriorhodopsin
Class: membrane protein
Keywords: PROTON PUMP, MEMBRANE PROTEIN, RETINAL PROTEIN, NMR, PHOTOreceptor, HALOARCHAEA, proton transport
Deposited on 2003-09-29, released 2003-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarium
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r2na_
  • Heterogens: RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2nA (A:)
    qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaatsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2nA (A:)
    qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge