PDB entry 1r2m

View 1r2m on RCSB PDB site
Description: Atomic resolution structure of the HFBII hydrophobin: a self-assembling amphiphile
Class: surface active protein
Keywords: amphiphile, fungi, self-assembly, protein surfactant, surface active protein
Deposited on 2003-09-29, released 2004-01-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.138
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrophobin II
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r2ma_
  • Chain 'B':
    Compound: Hydrophobin II
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r2mb_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2mA (A:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2mA (A:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r2mB (B:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2mB (B:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigt