PDB entry 1r2m

View 1r2m on RCSB PDB site
Description: Atomic resolution structure of the HFBII hydrophobin: a self-assembling amphiphile
Deposited on 2003-09-29, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.138
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r2ma_
  • Chain 'B':
    Domains in SCOP 1.67: d1r2mb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2mA (A:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2mA (A:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r2mB (B:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2mB (B:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigt