PDB entry 1r2j

View 1r2j on RCSB PDB site
Description: FkbI for Biosynthesis of Methoxymalonyl Extender Unit of Fk520 Polyketide Immunosuppresant
Class: oxidoreductase
Keywords: FK520; FK506; polyketide synthase; polyketide; acyl-CoA dehydrogenase; crystal structure; aldehyde dehydrogenase, OXIDOREDUCTASE
Deposited on 2003-09-28, released 2003-11-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.247
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein FkbI
    Species: Streptomyces hygroscopicus [TaxId:1912]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r2ja1, d1r2ja2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2jA (A:)
    mperdalltdlvgdraaewdtsgelprdllvrlgadgllcaevaaehgglglgsrengef
    tahvgslcsslrsvmtsqgmaawtvqrlgdagqratflkeltsgklaavgfserqagsdl
    samrtrvrldgdtavvdghkvwttaaayadhlvvfglqedgsgavvvvpadtpgvrverv
    pkpsgcraaghadlhldqvrvpagavlagsgaslpmlvaaslaygrksvawgcvgilrac
    rtaavahartreqfgrplgdhqlvaghiadlwtaeqiaarvceyasdhwdegspemvpat
    ilakhvaaeraaagaataaqvlasagareghvverayrdaklmeiiegssemcrvmlaqh
    alalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2jA (A:)
    erdalltdlvgdraaewdtsgelprdllvrlgadgllcaevaaehgglglgsrengefta
    hvgslcsslrsvmtsqgmaawtvqrlgdagqratflkeltsglaavgfserqagsdlsam
    rtrvrldgdtavvdghkvwttaaayadhlvvfglqedgsgavvvvpadtpgvrvervpkp
    sgcraaghadlhldqvrvpagavlagsgaslpmlvaaslaygrksvawgcvgilracrta
    avahartreqfgrplgdhqlvaghiadlwtaeqiaarvceyasdhmvpatilakhvaaer
    aaagaataaqvlasagaghvverayrdaklmeiiegssemcrvmlaqhalalp