PDB entry 1r2e

View 1r2e on RCSB PDB site
Description: human bcl-xl containing a glu to leu mutation at position 92
Deposited on 2003-09-26, released 2004-02-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r2ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2eA (A:)
    msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpswhla
    dspavngatghsssldarevipmaavkqalrlagdefelryrrafsdltsqlhitpgtay
    qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlep
    wiqenggwdtfvelygnnaaaesrkgqerfnehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2eA (A:)
    sqsnrelvvdflsyklsqkgyswsqfvipmaavkqalrlagdefelryrrafsdltsqlh
    itpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmaty
    lndhlepwiqenggwdtfvelyg