PDB entry 1r2b

View 1r2b on RCSB PDB site
Description: Crystal structure of the BCL6 BTB domain complexed with a SMRT co-repressor peptide
Deposited on 2003-09-26, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r2ba_
  • Chain 'B':
    Domains in SCOP 1.67: d1r2bb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2bA (A:)
    gsadsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysift
    dqlkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcr
    kfikase
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2bA (A:)
    adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
    lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
    ikase
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r2bB (B:)
    gsadsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysift
    dqlkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcr
    kfikase
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2bB (B:)
    dsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdql
    krnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfi
    kas