PDB entry 1r2b

View 1r2b on RCSB PDB site
Description: Crystal structure of the BCL6 BTB domain complexed with a SMRT co-repressor peptide
Class: transcription
Keywords: BTB domain, HDAC complex, B-cell lymphoma, transcriptional repression
Deposited on 2003-09-26, released 2003-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182 (2-126)
      • engineered (5)
      • engineered (64)
      • engineered (81)
    Domains in SCOPe 2.08: d1r2ba_
  • Chain 'B':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182
      • engineered (5)
      • engineered (64)
      • engineered (81)
    Domains in SCOPe 2.08: d1r2bb_
  • Chain 'C':
    Compound: nuclear receptor co-repressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2 OR CTG26
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y618 (2-18)
      • cloning artifact (0-1)
  • Chain 'D':
    Compound: nuclear receptor co-repressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2 OR CTG26
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2bA (A:)
    gsadsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysift
    dqlkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcr
    kfikase
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2bA (A:)
    adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
    lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
    ikase
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r2bB (B:)
    gsadsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysift
    dqlkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcr
    kfikase
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2bB (B:)
    dsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdql
    krnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfi
    kas
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.