PDB entry 1r2a

View 1r2a on RCSB PDB site
Description: the molecular basis for protein kinase a anchoring revealed by solution nmr
Class: transferase
Keywords: regulatory subunit, anchoring, four-helix bundle, transferase
Deposited on 1998-12-07, released 1998-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (camp-dependent protein kinase type II regulatory subunit)
    Species: Mus musculus [TaxId:10090]
    Gene: RIIA(1-44)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12367 (1-45)
      • cloning artifact (0)
      • cloning artifact (2)
      • insertion (22)
      • variant (23)
    Domains in SCOPe 2.08: d1r2aa1, d1r2aa2
  • Chain 'B':
    Compound: protein (camp-dependent protein kinase type II regulatory subunit)
    Species: Mus musculus [TaxId:10090]
    Gene: RIIA(1-44)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12367 (1-45)
      • cloning artifact (0)
      • cloning artifact (2)
      • insertion (22)
      • variant (23)
    Domains in SCOPe 2.08: d1r2ab1, d1r2ab2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r2aA (A:)
    hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r2aB (B:)
    hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr