PDB entry 1r24

View 1r24 on RCSB PDB site
Description: fab from murine igg3 kappa
Class: immune system
Keywords: preliminary, immune system
Deposited on 1998-11-05, released 1999-11-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.245
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (igg3-kappa antibody (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1R24 (0-205)
    Domains in SCOPe 2.05: d1r24a1, d1r24a2
  • Chain 'B':
    Compound: protein (igg3-kappa antibody (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1R24 (0-216)
    Domains in SCOPe 2.05: d1r24b1, d1r24b2
  • Chain 'C':
    Compound: protein (igg3-kappa antibody (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1R24 (0-205)
    Domains in SCOPe 2.05: d1r24c1, d1r24c2
  • Chain 'D':
    Compound: protein (igg3-kappa antibody (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1R24 (0-216)
    Domains in SCOPe 2.05: d1r24d1, d1r24d2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r24A (A:)
    diqmtqitsslsvslgdrviiscrasqdignflnwyqqkpdgslklliyytsrlqsgvps
    rfsgwgsgtdysltisnleeediatffcqqgktlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspiv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r24B (B:)
    dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny
    adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv
    ssatttapsvyplvpgcsdtsgssvtlgclvkgyfpgpvtvkwnygalssgvrtvssvlq
    sgfyslsslvtvpsstwpsqtvicnvahpasktdlik
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r24C (C:)
    diqmtqitsslsvslgdrviiscrasqdignflnwyqqkpdgslklliyytsrlqsgvps
    rfsgwgsgtdysltisnleeediatffcqqgktlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspiv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r24D (D:)
    dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny
    adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv
    ssatttapsvyplvpgcsdtsgssvtlgclvkgyfpgpvtvkwnygalssgvrtvssvlq
    sgfyslsslvtvpsstwpsqtvicnvahpasktdlik