PDB entry 1r22

View 1r22 on RCSB PDB site
Description: Crystal structure of the cyanobacterial metallothionein repressor SmtB (C14S/C61S/C121S mutant) in the Zn2alpha5-form
Deposited on 2003-09-25, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r22a_
  • Chain 'B':
    Domains in SCOP 1.69: d1r22b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r22A (A:)
    mtkpvlqdgetvvsqgthaaiaselqaiapevaqslaeffavladpnrlrllsllarsel
    svgdlaqaigvsesavshqlrslrnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqe
    sr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r22A (A:)
    lqaiapevaqslaeffavladpnrlrllsllarselsvgdlaqaigvsesavshqlrslr
    nlrlvsyrhvyyqlqdhhivalyqnaldhlqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r22B (B:)
    mtkpvlqdgetvvsqgthaaiaselqaiapevaqslaeffavladpnrlrllsllarsel
    svgdlaqaigvsesavshqlrslrnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqe
    sr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r22B (B:)
    qaiapevaqslaeffavladpnrlrllsllarselsvgdlaqaigvsesavshqlrslrn
    lrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqesr