PDB entry 1r22

View 1r22 on RCSB PDB site
Description: Crystal structure of the cyanobacterial metallothionein repressor SmtB (C14S/C61S/C121S mutant) in the Zn2alpha5-form
Class: transcription repressor
Keywords: Zinc, DNA binding protein, transcriptional regulation, winged HTH protein, TRANSCRIPTION REPRESSOR
Deposited on 2003-09-25, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional repressor smtB
    Species: Synechococcus elongatus [TaxId:1140]
    Gene: SMTB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30340
      • engineered (60)
      • engineered (120)
    Domains in SCOPe 2.07: d1r22a_
  • Chain 'B':
    Compound: Transcriptional repressor smtB
    Species: Synechococcus elongatus [TaxId:1140]
    Gene: SMTB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30340 (Start-121)
      • engineered (60)
      • engineered (120)
    Domains in SCOPe 2.07: d1r22b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r22A (A:)
    mtkpvlqdgetvvsqgthaaiaselqaiapevaqslaeffavladpnrlrllsllarsel
    svgdlaqaigvsesavshqlrslrnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqe
    sr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r22A (A:)
    lqaiapevaqslaeffavladpnrlrllsllarselsvgdlaqaigvsesavshqlrslr
    nlrlvsyrhvyyqlqdhhivalyqnaldhlqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r22B (B:)
    mtkpvlqdgetvvsqgthaaiaselqaiapevaqslaeffavladpnrlrllsllarsel
    svgdlaqaigvsesavshqlrslrnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqe
    sr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r22B (B:)
    qaiapevaqslaeffavladpnrlrllsllarselsvgdlaqaigvsesavshqlrslrn
    lrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqesr