PDB entry 1r21

View 1r21 on RCSB PDB site
Description: Solution Structure of human Ki67 FHA Domain
Class: cell cycle
Keywords: beta sandwich, CELL CYCLE
Deposited on 2003-09-25, released 2003-12-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antigen Ki-67
    Species: Homo sapiens [TaxId:9606]
    Gene: MKI67
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1r21a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1r21A (A:)
gspefpggmwptrrlvtikrsgvdgphfplslstclfgrgiecdiriqlpvvskqhckie
iheqeailhnfsstnptqvngsvidepvrlkhgdvitiidrsfryeneslqngrkstefp
rkireqep

    Sequence, based on observed residues (ATOM records): (download) 
    >1r21A (A:)
mwptrrlvtikrsgvdgphfplslstclfgrgiecdiriqlpvvskqhckieiheqeail
hnfsstnptqvngsvidepvrlkhgdvitiidrsfryene