PDB entry 1r1z

View 1r1z on RCSB PDB site
Description: The Crystal structure of the Carbohydrate recognition domain of the glycoprotein sorting receptor p58/ERGIC-53 reveals a novel metal binding site and conformational changes associated with calcium ion binding
Class: sugar binding protein
Keywords: beta-sheet, calcium-binding, lectin, mammalian, endoplasmic reticulum, SUGAR BINDING PROTEIN
Deposited on 2003-09-25, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.223
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ERGIC-53 protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: LMAN1 OR ERGIC53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62902 (21-End)
      • cloning artifact (6-20)
      • cloning artifact (7-17)
    Domains in SCOPe 2.07: d1r1za1, d1r1za2
  • Chain 'B':
    Compound: ERGIC-53 protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: LMAN1 OR ERGIC53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62902 (24-End)
      • cloning artifact (6-23)
      • cloning artifact (10-20)
    Domains in SCOPe 2.07: d1r1zb1, d1r1zb2
  • Chain 'C':
    Compound: ERGIC-53 protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: LMAN1 OR ERGIC53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62902 (24-End)
      • cloning artifact (6-23)
      • cloning artifact (10-20)
    Domains in SCOPe 2.07: d1r1zc1, d1r1zc2
  • Chain 'D':
    Compound: ERGIC-53 protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: LMAN1 OR ERGIC53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62902 (24-End)
      • cloning artifact (6-23)
      • cloning artifact (10-20)
    Domains in SCOPe 2.07: d1r1zd1, d1r1zd2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r1zA (A:)
    mgsshhhhhhssglvprgshmagtqaelphrrfeykysfkgphlvqsdgtvpfwahagna
    ipsadqiriapslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwytenqgl
    dgpvfgsadmwngvgiffdsfdndgkknnpaivvvgnngqinydhqndgatqalascqrd
    frnkpypvrakityyqktltvminngftpdkndyefcakvenmviptqghfgisaatggl
    addhdvlsfltfqltepgkeppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1zA (A:)
    hhhhssglvprgshmagtqahrrfeykysfkgphlvqsdgtvpfwahagnaipsadqiri
    apslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwytenqgldgpvfgsad
    mwngvgiffdsfdndgkknnpaivvvgnngqinydhqndgatqalascqrdfrnkpypvr
    akityyqktltvminngftpdkndyefcakvenmviptqghfgisaatggladdhdvlsf
    ltfqlte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r1zB (B:)
    mgsshhhhhhssglvprgshmagtqaelphrrfeykysfkgphlvqsdgtvpfwahagna
    ipsadqiriapslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwytenqgl
    dgpvfgsadmwngvgiffdsfdndgkknnpaivvvgnngqinydhqndgatqalascqrd
    frnkpypvrakityyqktltvminngftpdkndyefcakvenmviptqghfgisaatggl
    addhdvlsfltfqltepgkeppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1zB (B:)
    hhhhssglvprgshmagtqahrrfeykysfkgphlvqsdgtvpfwahagnaipsadqiri
    apslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwytenqgldgpvfgsad
    mwngvgiffdsfdndgkknnpaivvvgnngqinydhqndgatqalascqrdfrnkpypvr
    akityyqktltvminngftpdkndyefcakvenmviptqghfgisaatggladdhdvlsf
    ltfqlte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r1zC (C:)
    mgsshhhhhhssglvprgshmagtqaelphrrfeykysfkgphlvqsdgtvpfwahagna
    ipsadqiriapslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwytenqgl
    dgpvfgsadmwngvgiffdsfdndgkknnpaivvvgnngqinydhqndgatqalascqrd
    frnkpypvrakityyqktltvminngftpdkndyefcakvenmviptqghfgisaatggl
    addhdvlsfltfqltepgkeppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1zC (C:)
    hhhhssglvprgshmagtqahrrfeykysfkgphlvqsdgtvpfwahagnaipsadqiri
    apslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwytenqgldgpvfgsad
    mwngvgiffdsfdndgkknnpaivvvgnngqinydhqndgatqalascqrdfrnkpypvr
    akityyqktltvminngftpdkndyefcakvenmviptqghfgisaatggladdhdvlsf
    ltfqlte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r1zD (D:)
    mgsshhhhhhssglvprgshmagtqaelphrrfeykysfkgphlvqsdgtvpfwahagna
    ipsadqiriapslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwytenqgl
    dgpvfgsadmwngvgiffdsfdndgkknnpaivvvgnngqinydhqndgatqalascqrd
    frnkpypvrakityyqktltvminngftpdkndyefcakvenmviptqghfgisaatggl
    addhdvlsfltfqltepgkeppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1zD (D:)
    hhhhssglvprgshmagtqahrrfeykysfkgphlvqsdgtvpfwahagnaipsadqiri
    apslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwytenqgldgpvfgsad
    mwngvgiffdsfdndgkknnpaivvvgnngqinydhqndgatqalascqrdfrnkpypvr
    akityyqktltvminngftpdkndyefcakvenmviptqghfgisaatggladdhdvlsf
    ltfqlte