PDB entry 1r1v

View 1r1v on RCSB PDB site
Description: Crystal structure of the metal-sensing transcriptional repressor CzrA from Staphylococcus aureus in the Zn2-form
Deposited on 2003-09-25, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r1va_
  • Chain 'B':
    Domains in SCOP 1.69: d1r1vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r1vA (A:)
    mseqyseintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshql
    kllksvhlvkakrqgqsmiyslddihvatmlkqaihhanhpkesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1vA (A:)
    ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
    vkakrqgqsmiyslddihvatmlkqaihhanhpke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r1vB (B:)
    mseqyseintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshql
    kllksvhlvkakrqgqsmiyslddihvatmlkqaihhanhpkesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1vB (B:)
    ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
    vkakrqgqsmiyslddihvatmlkqaihhanhpkes