PDB entry 1r1u

View 1r1u on RCSB PDB site
Description: Crystal structure of the metal-sensing transcriptional repressor CzrA from Staphylococcus aureus in the apo-form
Deposited on 2003-09-25, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r1ua_
  • Chain 'B':
    Domains in SCOP 1.69: d1r1ub_
  • Chain 'C':
    Domains in SCOP 1.69: d1r1uc_
  • Chain 'D':
    Domains in SCOP 1.69: d1r1ud_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r1uA (A:)
    mseqyseintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshql
    kllksvhlvkakrqgqsmiyslddihvatmlkqaihhanhpkesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1uA (A:)
    ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
    vkakrqgqsmiyslddihvatmlkqaihhanhpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r1uB (B:)
    mseqyseintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshql
    kllksvhlvkakrqgqsmiyslddihvatmlkqaihhanhpkesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1uB (B:)
    ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
    vkakrqgqsmiyslddihvatmlkqaihhanhp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r1uC (C:)
    mseqyseintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshql
    kllksvhlvkakrqgqsmiyslddihvatmlkqaihhanhpkesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1uC (C:)
    seintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllks
    vhlvkakrqgqsmiyslddihvatmlkqaihhanhpke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r1uD (D:)
    mseqyseintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshql
    kllksvhlvkakrqgqsmiyslddihvatmlkqaihhanhpkesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1uD (D:)
    ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
    vkakrqgqsmiyslddihvatmlkqaihhanhpke