PDB entry 1r1t

View 1r1t on RCSB PDB site
Description: Crystal structure of the cyanobacterial metallothionein repressor SmtB in the apo-form
Class: transcription repressor
Keywords: Zinc, transcriptional regulation, winged HTH protein, DNA binding, TRANSCRIPTION REPRESSOR
Deposited on 2003-09-25, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.216
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional repressor smtB
    Species: Synechococcus elongatus [TaxId:1140]
    Gene: SMTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r1ta_
  • Chain 'B':
    Compound: Transcriptional repressor smtB
    Species: Synechococcus elongatus [TaxId:1140]
    Gene: SMTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r1tb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r1tA (A:)
    mtkpvlqdgetvvcqgthaaiaselqaiapevaqslaeffavladpnrlrllsllarsel
    cvgdlaqaigvsesavshqlrslrnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqe
    cr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1tA (A:)
    elqaiapevaqslaeffavladpnrlrllsllarselcvgdlaqaigvsesavshqlrsl
    rnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r1tB (B:)
    mtkpvlqdgetvvcqgthaaiaselqaiapevaqslaeffavladpnrlrllsllarsel
    cvgdlaqaigvsesavshqlrslrnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqe
    cr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1tB (B:)
    aiaselqaiapevaqslaeffavladpnrlrllsllarselcvgdlaqaigvsesavshq
    lrslrnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhl