PDB entry 1r1q
View 1r1q on RCSB PDB site
Description: Structural Basis for Differential Recognition of Tyrosine Phosphorylated Sites in the Linker for Activation of T cells (LAT) by the Adaptor Protein Gads
Class: peptide binding protein
Keywords: SH2, Gads, LAT, phosphopeptide, PEPTIDE BINDING PROTEIN
Deposited on
2003-09-24, released
2004-09-28
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: GRB2-related adaptor protein 2
Species: Mus musculus [TaxId:10090]
Gene: GADS
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1r1qa_ - Chain 'B':
Compound: GRB2-related adaptor protein 2
Species: Mus musculus [TaxId:10090]
Gene: GADS
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1r1qb_ - Chain 'C':
Compound: LAT pY191 peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: LAT pY191 peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1r1qA (A:)
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd
Sequence, based on observed residues (ATOM records): (download)
>1r1qA (A:)
idiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkvmrd
tkgnyflwtekfpslnklvdyyrttsiskqkqvflrd
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1r1qB (B:)
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.