PDB entry 1r1p

View 1r1p on RCSB PDB site
Description: Structural Basis for Differential Recognition of Tyrosine Phosphorylated Sites in the Linker for Activation of T cells (LAT) by the Adaptor Protein Gads
Class: peptide binding protein
Keywords: SH2, Gads, phosphopeptide, PEPTIDE BINDING PROTEIN
Deposited on 2003-09-24, released 2004-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GRB2-related adaptor protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: GADS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r1pa_
  • Chain 'B':
    Compound: GRB2-related adaptor protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: GADS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O89100 (2-99)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1r1pb1, d1r1pb2
  • Chain 'C':
    Compound: GRB2-related adaptor protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: GADS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O89100 (2-99)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1r1pc1, d1r1pc2
  • Chain 'D':
    Compound: GRB2-related adaptor protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: GADS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r1pd_
  • Chain 'E':
    Compound: LAT pY171 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R1P (Start-5)
  • Chain 'F':
    Compound: LAT pY171 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R1P (Start-5)
  • Chain 'G':
    Compound: LAT pY171 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R1P (Start-5)
  • Chain 'H':
    Compound: LAT pY171 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R1P (Start-5)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1r1pA (A:)
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd

    Sequence, based on observed residues (ATOM records): (download) 
    >1r1pA (A:)
iefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkvmrdtk
gnyflwtekfpslnklvdyyrttsiskqkqvflrd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1r1pB (B:)
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1r1pC (C:)
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >1r1pD (D:)
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd

    Sequence, based on observed residues (ATOM records): (download) 
    >1r1pD (D:)
iefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkvmrdtk
gnyflwtekfpslnklvdyyrttsiskqkqvflrd

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.