PDB entry 1r1f

View 1r1f on RCSB PDB site
Description: solution structure of the cyclotide palicourein: implications for the development of pharmaceutical and agricultural applications
Deposited on 2003-09-23, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r1fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r1fA (A:)
    tfcgetcrvipvctysaalgctcddrsdglckrngdp