PDB entry 1r1f

View 1r1f on RCSB PDB site
Description: Solution Structure of the Cyclotide Palicourein: Implications for the development of pharmaceutical and agricultural applications
Class: plant protein
Keywords: Palicourein, Cyclotide, PLANT PROTEIN
Deposited on 2003-09-23, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Palicourein
  Species: Palicourea condensata [TaxId:272141]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P84645 (0-33)
  Domains in SCOPe 2.08: d1r1fa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1r1fA (A:)
  tfcgetcrvipvctysaalgctcddrsdglckrngdp