PDB entry 1r1d

View 1r1d on RCSB PDB site
Description: Structure of a Carboxylesterase from Bacillus stearothermophilus
Class: hydrolase
Keywords: Structural genomics, MCSG, carboxylesterase, Bacillus stearothermophilus, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, HYDROLASE
Deposited on 2003-09-23, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxylesterase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: EST
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06174 (Start-246)
      • conflict (77)
      • conflict (154)
      • conflict (175)
      • conflict (180)
    Domains in SCOPe 2.07: d1r1da_
  • Chain 'B':
    Compound: carboxylesterase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: EST
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06174 (Start-246)
      • conflict (77)
      • conflict (154)
      • conflict (175)
      • conflict (180)
    Domains in SCOPe 2.07: d1r1db_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r1dA (A:)
    mmkivppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppee
    lvhtgpddwwqdvmngyqflknkgyekiavaglslggvfslklgytvpiegivtmcapmy
    ikseetmyegvleyareykkregkseeqieqemerfkqtpmktlkalqeliadvrahldl
    vyaptfvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediya
    flesldw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1dA (A:)
    ppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppeelvhtg
    pddwwqdvmngyqflknkgyekiavaglslggvfslklgytvpiegivtmcapmyiksee
    tmyegvleyareykkregkseeqieqemerfkqtpmktlkalqeliadvrahldlvyapt
    fvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediyaflesl
    dw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r1dB (B:)
    mmkivppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppee
    lvhtgpddwwqdvmngyqflknkgyekiavaglslggvfslklgytvpiegivtmcapmy
    ikseetmyegvleyareykkregkseeqieqemerfkqtpmktlkalqeliadvrahldl
    vyaptfvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediya
    flesldw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1dB (B:)
    ppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppeelvhtg
    pddwwqdvmngyqflknkgyekiavaglslggvfslklgytvpiegivtmcapmyiksee
    tmyegvleyareykkregkseeqieqemerfkqtpmktlkalqeliadvrahldlvyapt
    fvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediyaflesl
    dw