PDB entry 1r1c

View 1r1c on RCSB PDB site
Description: pseudomonas aeruginosa w48f/y72f/h83q/y108w-azurin re(phen)(co)3(his107)
Class: electron transport
Keywords: blue-copper, electron-transfer, rhenium, tunneling, radical, epr, electron transport
Deposited on 2003-09-23, released 2003-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU OR PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (47)
      • engineered (71)
      • engineered (82)
      • engineered (106-107)
    Domains in SCOPe 2.07: d1r1ca_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU OR PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (47)
      • engineered (71)
      • engineered (82)
      • engineered (106-107)
    Domains in SCOPe 2.07: d1r1cb_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU OR PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (47)
      • engineered (71)
      • engineered (82)
      • engineered (106-107)
    Domains in SCOPe 2.07: d1r1cc_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU OR PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (47)
      • engineered (71)
      • engineered (82)
      • engineered (106-107)
    Domains in SCOPe 2.07: d1r1cd_
  • Heterogens: CU1, REP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r1cA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvv
    tdgmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegehwmffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r1cB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvv
    tdgmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegehwmffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r1cC (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvv
    tdgmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegehwmffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r1cD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvv
    tdgmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegehwmffctfpghsal
    mkgtltlk