PDB entry 1r1b

View 1r1b on RCSB PDB site
Description: eprs second repeated element, nmr, minimized average structure
Class: ligase
Keywords: tRNA synthetase (ligase), protein transcription
Deposited on 1998-12-15, released 1999-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA synthetase
    Species: Cricetulus griseus [TaxId:10029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r1ba1, d1r1ba2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r1bA (A:)
    mvydkiaaqgevvrklkaekapkakvteavecllslkaeykektgkeyvpglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1bA (A:)
    mvydkiaaqgevvrklkaekapkakvteavecllslkaeykektgkeyvpglehhh