PDB entry 1r19

View 1r19 on RCSB PDB site
Description: Crystal Structure Analysis of S.epidermidis adhesin SdrG binding to Fibrinogen (Apo structure)
Class: cell adhesion
Keywords: MSCRAMM, SdrG native, CELL ADHESION
Deposited on 2003-09-23, released 2003-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.51 Å
R-factor: 0.251
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrinogen-binding protein SdrG
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: SDRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r19a1, d1r19a2
  • Chain 'B':
    Compound: fibrinogen-binding protein SdrG
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: SDRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r19b1, d1r19b2
  • Chain 'C':
    Compound: fibrinogen-binding protein SdrG
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: SDRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r19c1, d1r19c2
  • Chain 'D':
    Compound: fibrinogen-binding protein SdrG
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: SDRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r19d1, d1r19d2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r19A (A:)
    mgrshhhhhhgslvprgseqgsnvnhlikvtdqsitegyddsdgiikahdaenliydvtf
    evddkvksgdtmtvnidkntvpsdltdsfaipkikdnsgeiiatgtydntnkqitytftd
    yvdkyenikahlkltsyidkskvpnnntkldveyktalssvnktitveyqkpnenrtanl
    qsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddstiikvykvgdnq
    nlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikviskydpnkddytti
    qqtvtmqttineytgefrtasydntiafstssgqgqgdlppek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r19A (A:)
    snvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvkstmtvnidkntvps
    dltdsfipkikgeiiatgtydntnkqityttdyvdnikahlkltsyidkskvpnnntkld
    veyktalssvnktitveyqkpnenrtanlqsmftnidtknhtveqtiyinplrysaketn
    vnisgngdegstiiddstiikvykvgdnqnlpdsnriydyseyedvtnddyaqlgndvni
    nfgnidspyiikviskydptiqqtvtmqttineytgefrtasydnt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r19B (B:)
    mgrshhhhhhgslvprgseqgsnvnhlikvtdqsitegyddsdgiikahdaenliydvtf
    evddkvksgdtmtvnidkntvpsdltdsfaipkikdnsgeiiatgtydntnkqitytftd
    yvdkyenikahlkltsyidkskvpnnntkldveyktalssvnktitveyqkpnenrtanl
    qsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddstiikvykvgdnq
    nlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikviskydpnkddytti
    qqtvtmqttineytgefrtasydntiafstssgqgqgdlppek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r19B (B:)
    snvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvksgtmtvnidkntvp
    sdltdsfaipkikdnsgeiiatgtydntnkqitytftyenikahlkltsyidkskvpnnn
    tkldveyktalssvnktitveyqkpnenrtanlqsmftnidtknhtveqtiyinplrysa
    ketnvnisgngdegstiiddstiikvykvgdnqnlpdsnriydyseyedvtnddyaqlgn
    nndvninfgnidspyiikviskydpnkyttiqqtvtmqttineytgefrtasydntiafs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r19C (C:)
    mgrshhhhhhgslvprgseqgsnvnhlikvtdqsitegyddsdgiikahdaenliydvtf
    evddkvksgdtmtvnidkntvpsdltdsfaipkikdnsgeiiatgtydntnkqitytftd
    yvdkyenikahlkltsyidkskvpnnntkldveyktalssvnktitveyqkpnenrtanl
    qsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddstiikvykvgdnq
    nlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikviskydpnkddytti
    qqtvtmqttineytgefrtasydntiafstssgqgqgdlppek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r19C (C:)
    snvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvksgtmtvnidkntvp
    sdltdsfaipkikdnsiiatgtydntnkqitytfdkyenikahlkltsyidkskvpnnnt
    kldveyktalssvnktitveyqkpnenrtanlqsmftnidtknhtveqtiyinplrysak
    etnvnisgngdegstiiddstiikvykvgdnqnlpdsnriydyseyedvtnddyaqlgnn
    ndvninfgnidspyiikviskydpnyttiqqtvtmqttineytgefrtasydntiafs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r19D (D:)
    mgrshhhhhhgslvprgseqgsnvnhlikvtdqsitegyddsdgiikahdaenliydvtf
    evddkvksgdtmtvnidkntvpsdltdsfaipkikdnsgeiiatgtydntnkqitytftd
    yvdkyenikahlkltsyidkskvpnnntkldveyktalssvnktitveyqkpnenrtanl
    qsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddstiikvykvgdnq
    nlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikviskydpnkddytti
    qqtvtmqttineytgefrtasydntiafstssgqgqgdlppek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r19D (D:)
    snvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvksgdtmtvnidkntv
    psdltdsipkikdeiiatgtydntnkqityttdyvdnikahlkltsyidkskvpnnntkl
    dveyktalssvnktitveyqkpnenrtanlqsmftnidtknhtveqtiyinplrysaket
    nvnisgngdegstiiddstiikvykvgdnqnlpdsnriydyseyedvtnddyaqlgnnnd
    vninfgnidspyiikviskttiqqtvtmqttinetgefrtasydntiafsts