PDB entry 1r18

View 1r18 on RCSB PDB site
Description: Drosophila protein isoaspartyl methyltransferase with S-adenosyl-L-homocysteine
Class: transferase
Keywords: methyltransferase, isomerization, protein repair, S-adenosyl homocysteine, TRANSFERASE
Deposited on 2003-09-23, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-L-isoaspartate(D-aspartate)-O-methyltransferase
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: PCMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27869 (6-226)
      • cloning artifact (4-5)
    Domains in SCOPe 2.07: d1r18a1, d1r18a2
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r18A (A:)
    gspgihmawrsvgannedlirqlkdhgviasdavaqamketdrkhysprnpymdapqpig
    ggvtisaphmhafaleylrdhlkpgarildvgsgsgyltacfyryikakgvdadtrivgi
    ehqaelvrrskanlntddrsmldsgqllivegdgrkgyppnapynaihvgaaapdtptel
    inqlasggrlivpvgpdggsqymqqydkdangkvemtrlmgvmyvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r18A (A:)
    ihmawrsvgannedlirqlkdhgviasdavaqamketdrkhysprnpymdapqpigggvt
    isaphmhafaleylrdhlkpgarildvgsgsgyltacfyryikakgvdadtrivgiehqa
    elvrrskanlntddrsmldsgqllivegdgrkgyppnapynaihvgaaapdtptelinql
    asggrlivpvgpdggsqymqqydkdangkvemtrlmgvmyvpl