PDB entry 1r17

View 1r17 on RCSB PDB site
Description: Crystal Structure Analysis of S.epidermidis adhesin SdrG binding to Fibrinogen (adhesin-ligand complex)
Class: cell adhesion
Keywords: SdrG, MSCRAMM-ligand complex, SdrG-fibrinopeptide complex, CELL ADHESION
Deposited on 2003-09-23, released 2003-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.21
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrinogen-binding protein SdrG
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: SDRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r17a1, d1r17a2
  • Chain 'B':
    Compound: fibrinogen-binding protein SdrG
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: SDRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r17b1, d1r17b2
  • Chain 'C':
    Compound: fibrinopeptide B
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R17
  • Chain 'D':
    Compound: fibrinopeptide B
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R17
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r17A (A:)
    mgrshhhhhhgslvprgseqgsnvnhlikvtdqsitegyddsdgiikahdaenliydvtf
    evddkvksgdtmtvnidkntvpsdltdsfaipkikdnsgeiiatgtydntnkqitytftd
    yvdkyenikahlkltsyidkskvpnnntkldveyktalssvnktitveyqkpnenrtanl
    qsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddstiikvykvgdnq
    nlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikviskydpnkddytti
    qqtvtmqttineytgefrtasydntiafstssgqgqgdlppek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r17A (A:)
    gsnvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvksgdtmtvnidknt
    vpsdltdsfaipkikdnsgeiiatgtydntnkqitytftdyvdkyenikahlkltsyidk
    skvpnnntkldveyktalssvnktitveyqkpnenrtanlqsmftnidtknhtveqtiyi
    nplrysaketnvnisgngdegstiiddstiikvykvgdnqnlpdsnriydyseyedvtnd
    dyaqlgnnndvninfgnidspyiikviskydpnkddyttiqqtvtmqttineytgefrta
    sydntiafstssgqgqgdlpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r17B (B:)
    mgrshhhhhhgslvprgseqgsnvnhlikvtdqsitegyddsdgiikahdaenliydvtf
    evddkvksgdtmtvnidkntvpsdltdsfaipkikdnsgeiiatgtydntnkqitytftd
    yvdkyenikahlkltsyidkskvpnnntkldveyktalssvnktitveyqkpnenrtanl
    qsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddstiikvykvgdnq
    nlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikviskydpnkddytti
    qqtvtmqttineytgefrtasydntiafstssgqgqgdlppek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r17B (B:)
    gsnvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvksgdtmtvnidknt
    vpsdltdsfaipkikdnsgeiiatgtydntnkqitytftdyvdkyenikahlkltsyidk
    skvpnnntkldveyktalssvnktitveyqkpnenrtanlqsmftnidtknhtveqtiyi
    nplrysaketnvnisgngdegstiiddstiikvykvgdnqnlpdsnriydyseyedvtnd
    dyaqlgnnndvninfgnidspyiikviskydpnkddyttiqqtvtmqttineytgefrta
    sydntiafstssgqgqgdlp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.