PDB entry 1r16

View 1r16 on RCSB PDB site
Description: Aplysia ADP ribosyl cyclase with bound pyridylcarbinol and R5P
Class: hydrolase
Keywords: ADP-ribosyl cyclase, X-ray crystallography, cyclic ADP-ribose, NAADP, Ca2+ signalling, HYDROLASE
Deposited on 2003-09-23, released 2004-03-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r16a_
  • Chain 'B':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r16b_
  • Heterogens: N, PYF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r16A (A:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r16A (A:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r16B (B:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r16B (B:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla