PDB entry 1r15

View 1r15 on RCSB PDB site
Description: Aplysia ADP ribosyl cyclase with bound nicotinamide and R5P
Class: hydrolase
Keywords: ADP-ribosyl cyclase, X-ray crystallography, cyclic ADP-ribose, NAADP, Ca2+ signalling, HYDROLASE
Deposited on 2003-09-23, released 2004-03-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.244
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r15a_
  • Chain 'B':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r15b_
  • Chain 'C':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r15c_
  • Chain 'D':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r15d_
  • Chain 'E':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r15e_
  • Chain 'F':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r15f_
  • Chain 'G':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r15g_
  • Chain 'H':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r15h_
  • Heterogens: N, NCA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r15A (A:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r15A (A:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r15B (B:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r15B (B:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r15C (C:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r15C (C:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r15D (D:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r15D (D:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r15E (E:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r15E (E:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1r15F (F:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r15F (F:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1r15G (G:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r15G (G:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1r15H (H:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r15H (H:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla