PDB entry 1r11

View 1r11 on RCSB PDB site
Description: Structure Determination of the Dimeric Endonuclease in a Pseudo-face-centerd P21 space group
Class: translation, hydrolase
Keywords: RNA splicing; endonuclease; x-ray crystallography, TRANSLATION, HYDROLASE
Deposited on 2003-09-23, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.231
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA-intron endonuclease
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: EndA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29362 (Start-304)
      • conflict (151)
    Domains in SCOPe 2.08: d1r11a1, d1r11a2, d1r11a3, d1r11a4
  • Chain 'B':
    Compound: tRNA-intron endonuclease
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: EndA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29362 (Start-304)
      • conflict (151)
    Domains in SCOPe 2.08: d1r11b1, d1r11b2, d1r11b3, d1r11b4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r11A (A:)
    miggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm
    edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
    vvdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvt
    lslieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfg
    sefrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcf
    ervkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r11A (A:)
    ggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrmed
    fstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrlavv
    deeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtls
    lieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfgse
    frvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcfer
    vkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r11B (B:)
    miggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm
    edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
    vvdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvt
    lslieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfg
    sefrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcf
    ervkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r11B (B:)
    ggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrmed
    fstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrlavv
    deeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtls
    lieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfgse
    frvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcfer
    vkv