PDB entry 1r0u

View 1r0u on RCSB PDB site
Description: Crystal structure of ywiB protein from Bacillus subtilis
Class: structural genomics, unknown function
Keywords: structural genomics, ywiB protein, all beta protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-09-23, released 2003-12-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein ywiB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ywiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07624 (6-End)
      • see remark 999 (0-5)
    Domains in SCOPe 2.01: d1r0ua_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1r0uA (A:)
gfqsnamkqetpitlhvksvieddgnqeviefrttgfyyvkqnkvylsyyeehdlgkvkt
ivkvsegevlvmrsgavkmnqrfvtgastiakykmsfgelelktstksiqsdldeekgri
siaydmhvgdeqehlhnmtityeggtha

    Sequence, based on observed residues (ATOM records): (download) 
    >1r0uA (A:)
gfqsnamkqetpitlhvksvieddgnqeviefrttgfyyvkqnkvylsyyeehdlgkvkt
ivkvsegevlvmrsgavkmnqrfvtgastiakykmsfgelelktstksiqsdldeekgri
siaydmhvghlhnmtityeggt