PDB entry 1r0u

View 1r0u on RCSB PDB site
Description: Crystal structure of ywiB protein from Bacillus subtilis
Deposited on 2003-09-23, released 2003-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r0ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r0uA (A:)
    gfqsnamkqetpitlhvksvieddgnqeviefrttgfyyvkqnkvylsyyeehdlgkvkt
    ivkvsegevlvmrsgavkmnqrfvtgastiakykmsfgelelktstksiqsdldeekgri
    siaydmhvgdeqehlhnmtityeggtha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0uA (A:)
    gfqsnamkqetpitlhvksvieddgnqeviefrttgfyyvkqnkvylsyyeehdlgkvkt
    ivkvsegevlvmrsgavkmnqrfvtgastiakykmsfgelelktstksiqsdldeekgri
    siaydmhvghlhnmtityeggt