PDB entry 1r0s

View 1r0s on RCSB PDB site
Description: Crystal structure of ADP-ribosyl cyclase Glu179Ala mutant
Class: hydrolase
Keywords: ADP-ribosyl cyclase, X-ray crystallography, cyclic ADP-ribose, NAADP, Ca2+ signalling, HYDROLASE
Deposited on 2003-09-22, released 2004-03-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29241 (0-End)
      • engineered (178)
    Domains in SCOPe 2.02: d1r0sa_
  • Chain 'B':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29241 (0-End)
      • engineered (178)
    Domains in SCOPe 2.02: d1r0sb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r0sA (A:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyal
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0sA (A:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyal
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r0sB (B:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyal
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0sB (B:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyal
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla