PDB entry 1r0p

View 1r0p on RCSB PDB site
Description: Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-Met in complex with the microbial alkaloid K-252a
Class: transferase
Keywords: Receptor tyrosine kinase, Signal Transduction, Grb2, Shc, TRANSFERASE
Deposited on 2003-09-22, released 2003-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-311)
      • engineered (145)
      • engineered (185-186)
      • engineered (223)
    Domains in SCOPe 2.06: d1r0pa_
  • Heterogens: KSA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r0pA (A:)
    ntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihca
    vkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnf
    irnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglard
    mydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvn
    tfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh
    yvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0pA (A:)
    tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldkihcavksln
    ritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnet
    hnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmydke
    fdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypitvyllqg
    rrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnv
    k