PDB entry 1r0n

View 1r0n on RCSB PDB site
Description: Crystal Structure of Heterodimeric Ecdsyone receptor DNA binding complex
Class: Transcription/DNA
Keywords: Ecdysone receptor, nuclear receptor, DNA binding domain, Ultraspiracle, RXR, Transcription/DNA COMPLEX
Deposited on 2003-09-22, released 2003-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.233
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19793 (Start-76)
      • cloning artifact (77-80)
    Domains in SCOPe 2.08: d1r0na1, d1r0na2
  • Chain 'B':
    Compound: Ecdysone receptor
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: ECR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r0nb_
  • Chain 'C':
    Compound: Ecdsyone Response Element
  • Chain 'D':
    Compound: Ecdysone Response Element
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r0nA (A:)
    ftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqy
    cryqkclamgmkreavqaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0nA (A:)
    hicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycry
    qkclamgmkreavqaaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r0nB (B:)
    aprvqeelclvcgdrasgyhynaltcegckgffrrsvtksavycckfgracemdmymrrk
    cqecrlkkclavgmrpecvvpenqcamkrrekkaqkekdkmttspssqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0nB (B:)
    elclvcgdrasgyhynaltcegckgffrrsvtksavycckfgracemdmymrrkcqecrl
    kkclavgmrpecvvpenqcamkrrek
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.