PDB entry 1r0m

View 1r0m on RCSB PDB site
Description: Structure of Deinococcus radiodurans N-acylamino acid racemase at 1.3 : insights into a flexible binding pocket and evolution of enzymatic activity
Deposited on 2003-09-22, released 2004-09-22
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-22, with a file datestamp of 2004-09-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.155
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r0mA (A:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0mA (A:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r0mB (B:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0mB (B:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r0mC (C:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0mC (C:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r0mD (D:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0mD (D:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra