PDB entry 1r0d

View 1r0d on RCSB PDB site
Description: hip1r thatch domain core
Class: structural protein
Keywords: Endocytosis, Actin-binding, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, STRUCTURAL PROTEIN
Deposited on 2003-09-19, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.224
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Huntingtin Interacting Protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: HIP1R, HIP12, KIAA0655
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75146
      • modified residue (21)
      • modified residue (38-39)
      • modified residue (65)
      • modified residue (200)
    Domains in SCOPe 2.07: d1r0da_
  • Chain 'B':
    Compound: Huntingtin Interacting Protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: HIP1R, HIP12, KIAA0655
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75146
      • modified residue (21)
      • modified residue (38-39)
      • modified residue (65)
    Domains in SCOPe 2.07: d1r0db_
  • Chain 'D':
    Compound: Huntingtin Interacting Protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: HIP1R, HIP12, KIAA0655
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75146
      • modified residue (21)
      • modified residue (38-39)
      • modified residue (65)
    Domains in SCOPe 2.07: d1r0dd_
  • Chain 'E':
    Compound: Huntingtin Interacting Protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: HIP1R, HIP12, KIAA0655
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75146
      • modified residue (21)
      • modified residue (38-39)
      • modified residue (65)
    Domains in SCOPe 2.07: d1r0de_
  • Chain 'F':
    Compound: Huntingtin Interacting Protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: HIP1R, HIP12, KIAA0655
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75146
      • modified residue (21)
      • modified residue (38-39)
      • modified residue (65)
    Domains in SCOPe 2.07: d1r0df_
  • Chain 'G':
    Compound: Huntingtin Interacting Protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: HIP1R, HIP12, KIAA0655
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75146
      • modified residue (21)
      • modified residue (38-39)
      • modified residue (65)
    Domains in SCOPe 2.07: d1r0dg_
  • Chain 'H':
    Compound: Huntingtin Interacting Protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: HIP1R, HIP12, KIAA0655
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75146
      • modified residue (21)
      • modified residue (38-39)
      • modified residue (65)
    Domains in SCOPe 2.07: d1r0dh_
  • Chain 'I':
    Compound: Huntingtin Interacting Protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: HIP1R, HIP12, KIAA0655
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75146
      • modified residue (21)
      • modified residue (38-39)
      • modified residue (65)
      • modified residue (200)
    Domains in SCOPe 2.07: d1r0di_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r0dA (A:)
    gspefsldvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevneriln
    sctdlmkairllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatq
    lveaadkvvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvner
    aanvvastksgqeqiedrdtmdfsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0dA (A:)
    dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk
    airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk
    vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas
    tksgqeqiedrdtm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r0dB (B:)
    gspefsldvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevneriln
    sctdlmkairllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatq
    lveaadkvvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvner
    aanvvastksgqeqiedrdtmdfsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0dB (B:)
    dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk
    airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk
    vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas
    tksgqeqied
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r0dD (D:)
    gspefsldvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevneriln
    sctdlmkairllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatq
    lveaadkvvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvner
    aanvvastksgqeqiedrdtmdfsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0dD (D:)
    dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk
    airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk
    vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas
    tksgqeqied
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r0dE (E:)
    gspefsldvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevneriln
    sctdlmkairllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatq
    lveaadkvvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvner
    aanvvastksgqeqiedrdtmdfsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0dE (E:)
    dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk
    airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk
    vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas
    tksgqeqied
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1r0dF (F:)
    gspefsldvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevneriln
    sctdlmkairllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatq
    lveaadkvvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvner
    aanvvastksgqeqiedrdtmdfsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0dF (F:)
    dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk
    airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk
    vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas
    tksgqeqied
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1r0dG (G:)
    gspefsldvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevneriln
    sctdlmkairllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatq
    lveaadkvvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvner
    aanvvastksgqeqiedrdtmdfsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0dG (G:)
    dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk
    airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk
    vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas
    tksgqeqied
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1r0dH (H:)
    gspefsldvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevneriln
    sctdlmkairllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatq
    lveaadkvvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvner
    aanvvastksgqeqiedrdtmdfsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0dH (H:)
    dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk
    airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk
    vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas
    tksgqeqied
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1r0dI (I:)
    gspefsldvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevneriln
    sctdlmkairllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatq
    lveaadkvvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvner
    aanvvastksgqeqiedrdtmdfsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0dI (I:)
    dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk
    airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk
    vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas
    tksgqeqiedrdtm