PDB entry 1r0c

View 1r0c on RCSB PDB site
Description: Products in the T State of Aspartate Transcarbamylase: Crystal Structure of the Phosphate and N-carbamyl-L-aspartate Ligated Enzyme
Deposited on 2003-09-19, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0cA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0cB (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0cG (G:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0cH (H:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan