PDB entry 1r0c

View 1r0c on RCSB PDB site
Description: Products in the T State of Aspartate Transcarbamylase: Crystal Structure of the Phosphate and N-carbamyl-L-aspartate Ligated Enzyme
Class: transferase
Keywords: Aspartate Transcarbamylase, Aspartate Carbamoyltransferase, products, N-carbamyl-L-aspartate(CLA), phosphate, ATCase-products Complex, T state, transferase
Deposited on 2003-09-19, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB OR B4245 OR C5345 OR Z5856 OR ECS5222 OR SF4245 OR S4507
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r0ca1, d1r0ca2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRI OR B4244 OR C5344 OR Z5855 OR ECS5221
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r0cb1, d1r0cb2
  • Chain 'G':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB OR B4245 OR C5345 OR Z5856 OR ECS5222 OR SF4245 OR S4507
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r0cg1, d1r0cg2
  • Chain 'H':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRI OR B4244 OR C5344 OR Z5855 OR ECS5221
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r0ch1, d1r0ch2
  • Heterogens: ZN, PO4, NCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0cA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0cB (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0cG (G:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0cH (H:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan