PDB entry 1r0a

View 1r0a on RCSB PDB site
Description: Crystal structure of HIV-1 reverse transcriptase covalently tethered to DNA template-primer solved to 2.8 angstroms
Class: Transferase/immune system/DNA
Keywords: HIV-1, Transferase, immune system, DNA, Transferase-immune system-DNA COMPLEX
Deposited on 2003-09-19, released 2004-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-557)
      • engineered (257)
      • engineered (279)
    Domains in SCOPe 2.06: d1r0aa1, d1r0aa2
  • Chain 'B':
    Compound: reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-428)
      • engineered (279)
    Domains in SCOPe 2.06: d1r0ab1
  • Chain 'H':
    Compound: monoclonal antibody (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1R0A (0-224)
    Domains in SCOPe 2.06: d1r0ah1, d1r0ah2
  • Chain 'L':
    Compound: monoclonal antibody (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1R0A (0-210)
    Domains in SCOPe 2.06: d1r0al1, d1r0al2
  • Chain 'P':
    Compound: 5'-d(*c*cp*gp*tp*cp*cp*cp*tp*gp*tp*tp*cp*gp*ap*gp*cp*gp*cp*cp*gp*(2da))-3'
  • Chain 'T':
    Compound: 5'-d(*a*tp*gp*cp*ap*tp*cp*gp*gp*cp*gp*cp*tp*cp*gp*ap*ap*cp*ap*gp*gp*gp*ap*cp*gp*gp*t)-3'
  • Heterogens: GLC, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0aA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0aB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyql
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0aH (H:)
    qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
    ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
    vssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpadc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r0aL (L:)
    diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqyskfpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.