PDB entry 1r05

View 1r05 on RCSB PDB site
Description: Solution Structure of Max B-HLH-LZ
Class: transcription
Keywords: Basic-Helix-Loop-Helix-LeucineZipper Homodimer, TRANSCRIPTION
Deposited on 2003-09-19, released 2003-10-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: max protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Max
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61244 (1-82)
      • initiating met (0)
      • engineered (57)
      • engineered (60)
      • cloning artifact (83-86)
    Domains in SCOPe 2.04: d1r05a_
  • Chain 'B':
    Compound: max protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Max
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61244 (1-82)
      • initiating met (0)
      • engineered (57)
      • engineered (60)
      • cloning artifact (83-86)
    Domains in SCOPe 2.04: d1r05b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r05A (A:)
    madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrkvht
    lqqdiddlkrqnalleqqvralegsgc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r05B (B:)
    madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrkvht
    lqqdiddlkrqnalleqqvralegsgc