PDB entry 1r05

View 1r05 on RCSB PDB site
Description: Solution Structure of Max B-HLH-LZ
Class: transcription
Keywords: Basic-Helix-Loop-Helix-LeucineZipper Homodimer, TRANSCRIPTION
Deposited on 2003-09-19, released 2003-10-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: max protein
  Species: Homo sapiens [TaxId:9606]
  Gene: Max
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61244 (1-82)
    • initiating met (0)
    • engineered (57)
    • engineered (60)
    • cloning artifact (83-86)
  Domains in SCOPe 2.02: d1r05a_
• Chain 'B':
  Compound: max protein
  Species: Homo sapiens [TaxId:9606]
  Gene: Max
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61244 (1-82)
    • initiating met (0)
    • engineered (57)
    • engineered (60)
    • cloning artifact (83-86)
  Domains in SCOPe 2.02: d1r05b_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1r05A (A:)
  madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrkvht
  lqqdiddlkrqnalleqqvralegsgc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1r05B (B:)
  madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrkvht
  lqqdiddlkrqnalleqqvralegsgc